PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G11500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 158aa    MW: 17354.8 Da    PI: 9.9128
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G11500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.96.1e-142057643
                     HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     k  r   fskR ++i+ KA+EL +LC++ vav+ +s++
  ONIVA03G11500.1 20 KKVRDACFSKRHTTIFNKANELAILCGVMVAVVFVSPN 57
                     6678999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.489857IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-10868IPR002100Transcription factor, MADS-box
CDDcd002667.85E-17969No hitNo description
SuperFamilySSF554555.62E-15987IPR002100Transcription factor, MADS-box
PfamPF003192.2E-151965IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MVKCRARTTR KKIEIKRGDK KVRDACFSKR HTTIFNKANE LAILCGVMVA VVFVSPNANG  60
GIFSFGYPSV SSVANRFLAN APNNTSVSSS TQSGRDVEIH ELEREERELK EHLQASTDQN  120
KLLQEAIAAR DGGQLMLLLQ SDCSELGPKG LVRGGTKY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1342400.0AC134240.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBb0081I10, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.12e-67PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A0E0GJU31e-115A0A0E0GJU3_ORYNI; Uncharacterized protein
STRINGLOC_Os03g14850.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-13AGAMOUS-like 62